| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase [55060] (4 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.26.3: Mevalonate kinase [75450] (1 protein) |
| Protein Mevalonate kinase [75451] (2 species) |
| Species Archaeon Methanococcus jannaschii [TaxId:2190] [75452] (1 PDB entry) |
| Domain d1kkha2: 1kkh A:181-317 [72646] Other proteins in same PDB: d1kkha1 complexed with dio |
PDB Entry: 1kkh (more details), 2.4 Å
SCOP Domain Sequences for d1kkha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Archaeon Methanococcus jannaschii}
kgefeeflknckflivyaekrkkktaelvnevakienkdeifkeidkvidealkiknked
fgklmtknhellkklnistpkldrivdignrfgfgakltgaggggcviilvneekekell
kelnkedvrifncrmmn
Timeline for d1kkha2: