SCOPe 2.08: Domain d1kjya2: 1kjy A:31-60,A:182-349

Lineage for d1kjya2 (1kjy A:31-60,A:182-349)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
   Uniprot P10824

8. Domain d1kjya2: 1kjy A:31-60,A:182-349 [72625]
   Other proteins in same PDB: d1kjya1, d1kjya3, d1kjyc1
   bound to the goloco motif of rgs14, chains B and D
   complexed with cs, gdp, mg
   has additional subdomain(s) that are not in the common domain

Details for d1kjya2

PDB Entry: 1kjy, 2.7 Å

PDB Description: Crystal Structure of Human G[alpha]i1 Bound to the GoLoco Motif of RGS14

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d1kjya2:

Sequence; same for both SEQRES and ATOM records:

>d1kjya2 c.37.1.8 (A:31-60,A:182-349) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
arevkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkk
wihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnk
kdlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtk
nvqfvfdavtdviiknnlk

Timeline for d1kjya2:

• d1kjya2 first appeared in SCOP 1.61
  
• d1kjya2 appears in SCOPe 2.07