SCOPe 2.07: Domain d1kjjb1: 1kjj B:319-392

Lineage for d1kjjb1 (1kjj B:319-392)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)

7. Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)

8. Domain d1kjjb1: 1kjj B:319-392 [72610]
   Other proteins in same PDB: d1kjja2, d1kjja3, d1kjjb2, d1kjjb3
   complexed with ags, cl, mg, mpo, na

Details for d1kjjb1

PDB Entry: 1kjj, 1.75 Å

PDB Description: crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1kjjb1:

Sequence; same for both SEQRES and ATOM records:

>d1kjjb1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

Timeline for d1kjjb1:

• d1kjjb1 first appeared in SCOP 1.61
  
• d1kjjb1 appears in SCOPe 2.06
  
• d1kjjb1 appears in the current release, SCOPe 2.08