![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Glycinamide ribonucleotide transformylase PurT, N-domain [52448] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52449] (7 PDB entries) |
![]() | Domain d1kjja2: 1kjj A:2-112 [72608] Other proteins in same PDB: d1kjja1, d1kjja3, d1kjjb1, d1kjjb3 complexed with ags, cl, mg, mpo, na |
PDB Entry: 1kjj (more details), 1.75 Å
SCOPe Domain Sequences for d1kjja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kjja2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltm
Timeline for d1kjja2: