PDB entry 1kjj

View 1kjj on RCSB PDB site
Description: Crystal structure of glycniamide ribonucleotide transformylase in complex with Mg-ATP-gamma-S
Class: transferase
Keywords: ATP-grasp, purine biosynthesis, nucleotide, TRANSFERASE
Deposited on 2001-12-04, released 2002-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kjja1, d1kjja2, d1kjja3
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Gene: PURT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kjjb1, d1kjjb2, d1kjjb3
  • Heterogens: MG, NA, CL, AGS, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kjjA (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjjA (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplaler
    aqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvra
    flglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgv
    alataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kjjB (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kjjB (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqgrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsplalera
    qeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalhvraf
    lglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgva
    lataesvvdaierakhaagqvkvqg