Lineage for d1kile_ (1kil E:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040219Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 3040220Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 3040221Protein Complexin [88921] (1 species)
  7. 3040222Species Norway rat (Rattus norvegicus) [TaxId:10116] [88922] (1 PDB entry)
  8. 3040223Domain d1kile_: 1kil E: [72522]
    Other proteins in same PDB: d1kila_, d1kilb_, d1kilc_, d1kild_
    complex with SNAP25, synaptobrevin and syntaxin fragments
    complexed with mg

Details for d1kile_

PDB Entry: 1kil (more details), 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex
PDB Compounds: (E:) Complexin I SNARE-complex binding region

SCOPe Domain Sequences for d1kile_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kile_ h.1.15.1 (E:) Complexin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kkeeerqealrqaeeerkakyakmeaerevmrqgirdkygi

SCOPe Domain Coordinates for d1kile_:

Click to download the PDB-style file with coordinates for d1kile_.
(The format of our PDB-style files is described here.)

Timeline for d1kile_: