SCOPe 2.08: Domain d1kilb_: 1kil B:

Lineage for d1kilb_ (1kil B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Syntaxin 1A [88908] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88909] (6 PDB entries)
   Uniprot P32851 196-259
   a globular structure of a larger fragment containing this region is available; seepdb:1dn1, chain B

8. Domain d1kilb_: 1kil B: [72519]
   Other proteins in same PDB: d1kila_, d1kilc_, d1kild_, d1kile_
   complex with SNAP25, synaptobrevin and complexin fragments
   complexed with mg

Details for d1kilb_

PDB Entry: 1kil, 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex

PDB Compounds: (B:) Syntaxin SNARE motif short

SCOPe Domain Sequences for d1kilb_:

Sequence; same for both SEQRES and ATOM records:

>d1kilb_ h.1.15.1 (B:) Syntaxin 1A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyveravsd

Timeline for d1kilb_:

• d1kilb_ first appeared in SCOP 1.61
  
• d1kilb_ appears in SCOPe 2.07