SCOPe 2.08: Domain d1kila_: 1kil A:

Lineage for d1kila_ (1kil A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Synaptobrevin [88903] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88904] (4 PDB entries)

8. Domain d1kila_: 1kil A: [72518]
   Other proteins in same PDB: d1kilb_, d1kilc_, d1kild_, d1kile_
   complex with SNAP25, syntaxin and complexin fragments
   complexed with mg

Details for d1kila_

PDB Entry: 1kil, 2.3 Å

PDB Description: Three-dimensional structure of the complexin/SNARE complex

PDB Compounds: (A:) Synaptobrevin SNARE motif

SCOPe Domain Sequences for d1kila_:

Sequence; same for both SEQRES and ATOM records:

>d1kila_ h.1.15.1 (A:) Synaptobrevin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaaklkrk
ywwkn

Timeline for d1kila_:

• d1kila_ first appeared in SCOP 1.61
  
• d1kila_ appears in SCOPe 2.07