Lineage for d1jr0h_ (1jr0 H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949390Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 949391Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 949401Domain d1jr0h_: 1jr0 H: [71819]
    complexed with a24

Details for d1jr0h_

PDB Entry: 1jr0 (more details), 1.3 Å

PDB Description: cholera toxin b-pentamer with ligand bmsc-0011
PDB Compounds: (H:) cholera toxin b subunit

SCOPe Domain Sequences for d1jr0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr0h_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1jr0h_:

Click to download the PDB-style file with coordinates for d1jr0h_.
(The format of our PDB-style files is described here.)

Timeline for d1jr0h_: