Lineage for d1jr0h_ (1jr0 H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166279Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 166280Protein Cholera toxin [50208] (1 species)
  7. 166281Species Vibrio cholerae [TaxId:666] [50209] (11 PDB entries)
  8. 166291Domain d1jr0h_: 1jr0 H: [71819]

Details for d1jr0h_

PDB Entry: 1jr0 (more details), 1.3 Å

PDB Description: cholera toxin b-pentamer with ligand bmsc-0011

SCOP Domain Sequences for d1jr0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr0h_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOP Domain Coordinates for d1jr0h_:

Click to download the PDB-style file with coordinates for d1jr0h_.
(The format of our PDB-style files is described here.)

Timeline for d1jr0h_: