| Class b: All beta proteins [48724] (180 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Cholera toxin [50208] (2 species) barrel, partly opened; n*=5, S*=10 |
| Species Vibrio cholerae [TaxId:666] [50209] (29 PDB entries) Uniprot P01556 22-124 |
| Domain d1jr0h_: 1jr0 H: [71819] complexed with a24 |
PDB Entry: 1jr0 (more details), 1.3 Å
SCOPe Domain Sequences for d1jr0h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr0h_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d1jr0h_:
View in 3DDomains from other chains: (mouse over for more information) d1jr0d_, d1jr0e_, d1jr0f_, d1jr0g_ |