Lineage for d1jnzb_ (1jnz B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) 
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (6 proteins) 
Protein Adenylylsulfate reductase B subunit [69726] (1 species) Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (2 PDB entries) 
Domain d1jnzb_: 1jnz B: [71769]
Other proteins in same PDB: d1jnza1, d1jnza2, d1jnza3, d1jnzc1, d1jnzc2, d1jnzc3
Details for d1jnzb_
PDB Entry: 1jnz (more details), 2.5 Å
PDB Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution
SCOP Domain Sequences for d1jnzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnzb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka
SCOP Domain Coordinates for d1jnzb_:
Click to download the PDB-style file with coordinates for d1jnzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jnzb_:
- d1jnzb_ is new in SCOP 1.61
- d1jnzb_ appears in SCOP 1.63
- d1jnzb_ appears in the current release, SCOPe 2.08
View in 3D
