Lineage for d1jnzc1 (1jnz C:2503-2643)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 150700Fold a.7: Spectrin repeat-like [46965] (7 superfamilies)
  4. 150734Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase C-terminal domain [46977] (1 family) (S)
  5. 150735Family a.7.3.1: Succinate dehydrogenase/fumarate reductase C-terminal domain [46978] (3 proteins)
  6. 150736Protein Adenylylsulfate reductase A subunit [68978] (1 species)
  7. 150737Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [68979] (2 PDB entries)
  8. 150741Domain d1jnzc1: 1jnz C:2503-2643 [71770]
    Other proteins in same PDB: d1jnza2, d1jnza3, d1jnzb_, d1jnzc2, d1jnzc3, d1jnzd_

Details for d1jnzc1

PDB Entry: 1jnz (more details), 2.5 Å

PDB Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnzc1 a.7.3.1 (C:2503-2643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus}
taddvnpeyilpwqglvrlqkimdeyaagiatiyktnekmlqralellaflkedleklaa
rdlhelmrawelvhrvwtaeahvrhmlfrketrwpgyyyrtdypelndeewkcfvcskyd
aekdewtfekvpyvqviewsf

SCOP Domain Coordinates for d1jnzc1:

Click to download the PDB-style file with coordinates for d1jnzc1.
(The format of our PDB-style files is described here.)

Timeline for d1jnzc1: