Lineage for d1jnzc3 (1jnz C:2257-2401)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198685Fold d.168: Succinate dehydrogenase/fumarate reductase catalytic domain [56424] (1 superfamily)
  4. 198686Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56425] (1 family) (S)
  5. 198687Family d.168.1.1: Succinate dehydrogenase/fumarate reductase catalytic domain [56426] (4 proteins)
  6. 198688Protein Adenylylsulfate reductase A subunit [69852] (1 species)
  7. 198689Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69853] (2 PDB entries)
  8. 198693Domain d1jnzc3: 1jnz C:2257-2401 [71772]
    Other proteins in same PDB: d1jnza1, d1jnza2, d1jnzb_, d1jnzc1, d1jnzc2, d1jnzd_

Details for d1jnzc3

PDB Entry: 1jnz (more details), 2.5 Å

PDB Description: Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6 resolution

SCOP Domain Sequences for d1jnzc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jnzc3 d.168.1.1 (C:2257-2401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus}
fehrfipfrfkdgygpvgawflffkckaknaygeeyiktraaelekykpygaaqpiptpl
rnhqvmleimdgnqpiymhteealaelaggdkkklkhiyeeafedfldmtvsqallwacq
nidpqeqpseaapaepyimgshsge

SCOP Domain Coordinates for d1jnzc3:

Click to download the PDB-style file with coordinates for d1jnzc3.
(The format of our PDB-style files is described here.)

Timeline for d1jnzc3: