Lineage for d1jlwb2 (1jlw B:1-90)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168561Protein Class delta GST [81366] (5 species)
    formerly a part of class theta enzymes
  7. 1168572Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [75235] (1 PDB entry)
  8. 1168574Domain d1jlwb2: 1jlw B:1-90 [71744]
    Other proteins in same PDB: d1jlwa1, d1jlwb1

Details for d1jlwb2

PDB Entry: 1jlw (more details), 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4
PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d1jlwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlwb2 c.47.1.5 (B:1-90) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

SCOPe Domain Coordinates for d1jlwb2:

Click to download the PDB-style file with coordinates for d1jlwb2.
(The format of our PDB-style files is described here.)

Timeline for d1jlwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlwb1