SCOP 1.61: Domain d1jlwb2: 1jlw B:1-90

Lineage for d1jlwb2 (1jlw B:1-90)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Insect (Anopheles dirus b), isozyme 1-4 [75235] (1 PDB entry)

8. Domain d1jlwb2: 1jlw B:1-90 [71744]
   Other proteins in same PDB: d1jlwa1, d1jlwb1

Details for d1jlwb2

PDB Entry: 1jlw, 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4

SCOP Domain Sequences for d1jlwb2:

Sequence; same for both SEQRES and ATOM records:

>d1jlwb2 c.47.1.5 (B:1-90) Glutathione S-transferase {Insect (Anopheles dirus b), isozyme 1-4}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

Timeline for d1jlwb2:

• d1jlwb2 is new in SCOP 1.61
  
• d1jlwb2 appears in SCOP 1.63
  
• d1jlwb2 appears in the current release, SCOPe 2.08