Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.72: Ribokinase-like [53612] (2 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (5 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (4 proteins) |
Protein 2-keto-3-deoxygluconate kinase [75295] (1 species) |
Species Thermotoga maritima, TM0067 [TaxId:2336] [75296] (1 PDB entry) |
Domain d1j5vd_: 1j5v D: [71588] structural genomics protein; complexed with 2of, mse, ni, ni1, ni3, of1, zn3 |
PDB Entry: 1j5v (more details), 2.3 Å
SCOP Domain Sequences for d1j5vd_:
Sequence, based on SEQRES records: (download)
>d1j5vd_ c.72.1.1 (D:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067} hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk vmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktvgi tlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkk aefaaaasclkhtipgdfvvlsieeieklas
>d1j5vd_ c.72.1.1 (D:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067} hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk vmipfmeyvdvlianeediekvlgisvegnreayakiaeevtrkynfktvgitlresisa tvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaas clkhtipgdfvvlsieeieklas
Timeline for d1j5vd_: