Lineage for d1j5vd_ (1j5v D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 591165Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 591166Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 591167Family c.72.1.1: Ribokinase-like [53614] (6 proteins)
  6. 591168Protein 2-keto-3-deoxygluconate kinase [75295] (2 species)
  7. 591169Species Thermotoga maritima, TM0067 [TaxId:2336] [75296] (1 PDB entry)
  8. 591173Domain d1j5vd_: 1j5v D: [71588]
    structural genomics
    complexed with 2of, mse, ni, ni1, ni3, of1, zn3

Details for d1j5vd_

PDB Entry: 1j5v (more details), 2.3 Å

PDB Description: Crystal structure of 2-keto-3-deoxygluconate kinase (TM0067) from Thermotoga maritima at 2.3 A resolution

SCOP Domain Sequences for d1j5vd_:

Sequence, based on SEQRES records: (download)

>d1j5vd_ c.72.1.1 (D:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067}
hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
vmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktvgi
tlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkk
aefaaaasclkhtipgdfvvlsieeieklas

Sequence, based on observed residues (ATOM records): (download)

>d1j5vd_ c.72.1.1 (D:) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067}
hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
vmipfmeyvdvlianeediekvlgisvegnreayakiaeevtrkynfktvgitlresisa
tvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaas
clkhtipgdfvvlsieeieklas

SCOP Domain Coordinates for d1j5vd_:

Click to download the PDB-style file with coordinates for d1j5vd_.
(The format of our PDB-style files is described here.)

Timeline for d1j5vd_: