PDB entry 1j5v

View 1j5v on RCSB PDB site
Description: Crystal structure of 2-keto-3-deoxygluconate kinase (TM0067) from Thermotoga maritima at 2.3 A resolution
Deposited on 2002-07-05, released 2002-07-24
The last revision prior to the SCOP 1.63 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1j5va_
  • Chain 'B':
    Domains in SCOP 1.63: d1j5vb_
  • Chain 'C':
    Domains in SCOP 1.63: d1j5vc_
  • Chain 'D':
    Domains in SCOP 1.63: d1j5vd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j5vA (A:)
    hhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpn
    nplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakred
    fdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeea
    qkvmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktv
    gitlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsq
    kkaefaaaasclkhtipgdfvvlsieeieklas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5vA (A:)
    hhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpn
    nplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakred
    fdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeea
    qkvmipfmeyvdvlianeediekvlgisnreayakiaeevtrkynfktvgitlresisat
    vnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaasc
    lkhtipgdfvvlsieeieklas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1j5vB (B:)
    hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
    lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
    wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
    vmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktvgi
    tlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkk
    aefaaaasclkhtipgdfvvlsieeieklas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5vB (B:)
    hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
    lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
    wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
    vmipfmeyvdvlianeediekvlgisvenreayakiaeevtrkynfktvgitlresisat
    vnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaasc
    lkhtipgdfvvlsieeieklas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1j5vC (C:)
    hhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpn
    nplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakred
    fdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeea
    qkvmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktv
    gitlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsq
    kkaefaaaasclkhtipgdfvvlsieeieklas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5vC (C:)
    hhhmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpn
    nplgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakred
    fdwekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeea
    qkvmipfmeyvdvlianeediekvlgisnreayakiaeevtrkynfktvgitlresisat
    vnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaasc
    lkhtipgdfvvlsieeieklas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1j5vD (D:)
    hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
    lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
    wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
    vmipfmeyvdvlianeediekvlgisvegldlktgklnreayakiaeevtrkynfktvgi
    tlresisatvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkk
    aefaaaasclkhtipgdfvvlsieeieklas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j5vD (D:)
    hmkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnp
    lgdaaaghlrkfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfd
    wekildgarwfhfsgitpplgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqk
    vmipfmeyvdvlianeediekvlgisvegnreayakiaeevtrkynfktvgitlresisa
    tvnywsvmvfengqphfsnryeihivdrvgagdsfagaliygslmgfdsqkkaefaaaas
    clkhtipgdfvvlsieeieklas