Lineage for d1iw7o_ (1iw7 O:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361861Fold a.143: RNA polymerase omega subunit [63561] (1 superfamily)
    4 helices; irregular array
  4. 361862Superfamily a.143.1: RNA polymerase omega subunit [63562] (1 family) (S)
  5. 361863Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
  6. 361864Protein RNA polymerase omega subunit [63564] (2 species)
  7. 361867Species Thermus thermophilus [TaxId:274] [74729] (1 PDB entry)
  8. 361869Domain d1iw7o_: 1iw7 O: [71484]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7p1, d1iw7p2, d1iw7p3
    complexed with mg, pb

Details for d1iw7o_

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution

SCOP Domain Sequences for d1iw7o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7o_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOP Domain Coordinates for d1iw7o_:

Click to download the PDB-style file with coordinates for d1iw7o_.
(The format of our PDB-style files is described here.)

Timeline for d1iw7o_: