| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.74: DCoH-like [55247] (4 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins) |
| Protein RNA polymerase alpha [55259] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75478] (1 PDB entry) |
| Domain d1iw7a1: 1iw7 A:1-49,A:173-229 [71470] Other proteins in same PDB: d1iw7a2, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k2, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p1, d1iw7p2, d1iw7p3 |
PDB Entry: 1iw7 (more details), 2.6 Å
SCOP Domain Sequences for d1iw7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iw7a1 d.74.3.1 (A:1-49,A:173-229) RNA polymerase alpha {Thermus thermophilus}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
Timeline for d1iw7a1: