| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (2 species) |
| Species Thermus thermophilus [TaxId:274] [74729] (2 PDB entries) |
| Domain d1iw7o_: 1iw7 O: [71484] Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7f1, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7p1, d1iw7p2, d1iw7p3 |
PDB Entry: 1iw7 (more details), 2.6 Å
SCOP Domain Sequences for d1iw7o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iw7o_ a.143.1.1 (O:) RNA polymerase omega subunit {Thermus thermophilus}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge
Timeline for d1iw7o_: