| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) ![]() |
| Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
| Protein Sigma70 [88661] (1 species) |
| Species Thermus thermophilus [TaxId:274] [88662] (2 PDB entries) |
| Domain d1iw7p1: 1iw7 P:258-318 [83089] Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p2, d1iw7p3 |
PDB Entry: 1iw7 (more details), 2.6 Å
SCOP Domain Sequences for d1iw7p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iw7p1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e
Timeline for d1iw7p1: