Lineage for d1iu1a_ (1iu1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523336Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) (S)
    contains an additional N-terminal strand
  5. 1523358Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
    automatically mapped to Pfam PF02883
  6. 1523368Protein Gamma1-adaptin domain [74858] (1 species)
  7. 1523369Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)
  8. 1523372Domain d1iu1a_: 1iu1 A: [71428]

Details for d1iu1a_

PDB Entry: 1iu1 (more details), 1.8 Å

PDB Description: crystal structure of human gamma1-adaptin ear domain
PDB Compounds: (A:) gamma1-adaptin

SCOPe Domain Sequences for d1iu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu1a_ b.1.10.2 (A:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
gipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOPe Domain Coordinates for d1iu1a_:

Click to download the PDB-style file with coordinates for d1iu1a_.
(The format of our PDB-style files is described here.)

Timeline for d1iu1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iu1b_