Lineage for d1iu1a_ (1iu1 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161622Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (2 families) (S)
  5. 161638Family b.1.10.2: Gamma1-adaptin ear domain [74857] (1 protein)
  6. 161639Protein Gamma1-adaptin ear domain [74858] (1 species)
  7. 161640Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)
  8. 161643Domain d1iu1a_: 1iu1 A: [71428]

Details for d1iu1a_

PDB Entry: 1iu1 (more details), 1.8 Å

PDB Description: crystal structure of human gamma1-adaptin ear domain

SCOP Domain Sequences for d1iu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu1a_ b.1.10.2 (A:) Gamma1-adaptin ear domain {Human (Homo sapiens)}
gipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOP Domain Coordinates for d1iu1a_:

Click to download the PDB-style file with coordinates for d1iu1a_.
(The format of our PDB-style files is described here.)

Timeline for d1iu1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iu1b_