| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
| Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins) consist of a single subdomain automatically mapped to Pfam PF02883 |
| Protein Gamma1-adaptin domain [74858] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries) |
| Domain d1iu1a_: 1iu1 A: [71428] |
PDB Entry: 1iu1 (more details), 1.8 Å
SCOPe Domain Sequences for d1iu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iu1a_ b.1.10.2 (A:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
gipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlql
lspsssivpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq
Timeline for d1iu1a_: