Lineage for d1iruh_ (1iru H:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263343Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 263344Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 263459Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 263616Protein Proteasome beta subunit (catalytic) [56252] (3 species)
  7. 263689Species Cow (Bos taurus) [TaxId:9913] [75567] (1 PDB entry)
  8. 263692Domain d1iruh_: 1iru H: [71359]
    Other proteins in same PDB: d1irua_, d1irub_, d1iruc_, d1irud_, d1irue_, d1iruf_, d1irug_, d1iruo_, d1irup_, d1iruq_, d1irur_, d1irus_, d1irut_, d1iruu_

Details for d1iruh_

PDB Entry: 1iru (more details), 2.75 Å

PDB Description: Crystal Structure of the mammalian 20S proteasome at 2.75 A resolution

SCOP Domain Sequences for d1iruh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus)}
ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
esgverqvllgdqipkfavatl

SCOP Domain Coordinates for d1iruh_:

Click to download the PDB-style file with coordinates for d1iruh_.
(The format of our PDB-style files is described here.)

Timeline for d1iruh_: