Lineage for d1ikop_ (1iko P:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224972Family b.6.1.5: Ephrin-b2 ectodomain [74874] (1 protein)
    eukaryotic signalling domain probably related to cupredoxins but lacking the metal-binding site
  6. 224973Protein Ephrin-b2 ectodomain [74875] (1 species)
  7. 224974Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries)
  8. 224975Domain d1ikop_: 1iko P: [71243]
    complexed with man, nag

Details for d1ikop_

PDB Entry: 1iko (more details), 1.92 Å

PDB Description: crystal structure of the murine ephrin-b2 ectodomain

SCOP Domain Sequences for d1ikop_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus)}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
drctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegld
nqeggvcqtramkilmkvgqd

SCOP Domain Coordinates for d1ikop_:

Click to download the PDB-style file with coordinates for d1ikop_.
(The format of our PDB-style files is described here.)

Timeline for d1ikop_: