Lineage for d1ikop_ (1iko P:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) Superfamily b.6.1: Cupredoxins [49503] (5 families) 
Family b.6.1.5: Ephrin-b2 ectodomain [74874] (1 protein) Protein Ephrin-b2 ectodomain [74875] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [74876] (2 PDB entries) 
Domain d1ikop_: 1iko P: [71243]
Details for d1ikop_
PDB Entry: 1iko (more details), 1.92 Å
PDB Description: crystal structure of the murine ephrin-b2 ectodomain
SCOP Domain Sequences for d1ikop_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus)}
sivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqa
drctikkentpllncarpdqdvkftikfqefspnlwglefqknkdyyiistsngslegld
nqeggvcqtramkilmkvgqd
SCOP Domain Coordinates for d1ikop_:
Click to download the PDB-style file with coordinates for d1ikop_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ikop_:
- d1ikop_ is new in SCOP 1.61
- d1ikop_ appears in SCOP 1.63
- d1ikop_ appears in the current release, SCOPe 2.08
View in 3D