Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species) |
Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [55359] (5 PDB entries) |
Domain d1ihxb2: 1ihx B:149-312 [71214] Other proteins in same PDB: d1ihxa1, d1ihxb1, d1ihxc1, d1ihxd1 complexed with snd, so4 |
PDB Entry: 1ihx (more details), 2.8 Å
SCOPe Domain Sequences for d1ihxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihxb2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd
Timeline for d1ihxb2: