Lineage for d1ihxb2 (1ihx B:149-312)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193860Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
  4. 193861Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
  5. 193862Family d.81.1.1: GAPDH-like [55348] (2 proteins)
  6. 193870Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (13 species)
  7. 193952Species Lobster (Palinurus versicolor) [55359] (5 PDB entries)
  8. 193960Domain d1ihxb2: 1ihx B:149-312 [71214]
    Other proteins in same PDB: d1ihxa1, d1ihxb1, d1ihxc1, d1ihxd1

Details for d1ihxb2

PDB Entry: 1ihx (more details), 2.8 Å

PDB Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry
PDB Compounds: (B:)

SCOP Domain Sequences for d1ihxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihxb2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
cttnclapvakvlhenfeiveglmttvhavtatqktvdgpsakdwrggrgaaqniipsst
gaakavgkvipeldgkltgmafrvptpnvsvvdltvrlgkecsyddikaamktasegplq
gvlgyteddvvscdftgdnrssifdakagiqlsktfvkvvswyd

SCOP Domain Coordinates for d1ihxb2:

Click to download the PDB-style file with coordinates for d1ihxb2.
(The format of our PDB-style files is described here.)

Timeline for d1ihxb2: