PDB entry 1ihx

View 1ihx on RCSB PDB site
Description: Crystal structure of two D-glyceraldehyde-3-phosphate dehydrogenase complexes: a case of asymmetry
Class: oxidoreductase
Keywords: GAPDH, asymmetry, SNAD, OXIDOREDUCTASE
Deposited on 2001-04-20, released 2002-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.177
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.07: d1ihxa1, d1ihxa2
  • Chain 'B':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.07: d1ihxb1, d1ihxb2
  • Chain 'C':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.07: d1ihxc1, d1ihxc2
  • Chain 'D':
    Compound: glyceraldehyde 3-phosphate dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • see remark 999 (17)
      • see remark 999 (57)
      • see remark 999 (259)
    Domains in SCOPe 2.07: d1ihxd1, d1ihxd2
  • Heterogens: SO4, SND, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihxA (A:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihxB (B:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihxC (C:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihxD (D:)
    skigingfgrigrlvlrtalemgaqvvavndpfialeymvymfkydsthgmfkgevkved
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamktasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa