SCOPe 2.05: Domain d1igob_: 1igo B:

Lineage for d1igob_ (1igo B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry)

8. Domain d1igob_: 1igo B: [71210]
   complexed with so4

Details for d1igob_

PDB Entry: 1igo, 2.2 Å

PDB Description: Family 11 xylanase

PDB Compounds: (B:) family 11 xylanase

SCOPe Domain Sequences for d1igob_:

Sequence; same for both SEQRES and ATOM records:

>d1igob_ b.29.1.11 (B:) Xylanase II {Bacillus subtilis, B230 [TaxId: 1423]}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl

Timeline for d1igob_:

• d1igob_ first appeared in SCOP 1.61
  
• d1igob_ appears in SCOPe 2.04
  
• d1igob_ appears in SCOPe 2.06
  
• d1igob_ appears in the current release, SCOPe 2.08