Lineage for d1igob_ (1igo B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 165029Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 165041Protein Xylanase II [49979] (13 species)
  7. 165073Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry)
  8. 165075Domain d1igob_: 1igo B: [71210]

Details for d1igob_

PDB Entry: 1igo (more details), 2.2 Å

PDB Description: Family 11 xylanase

SCOP Domain Sequences for d1igob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igob_ b.29.1.11 (B:) Xylanase II {Bacillus subtilis, B230}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl

SCOP Domain Coordinates for d1igob_:

Click to download the PDB-style file with coordinates for d1igob_.
(The format of our PDB-style files is described here.)

Timeline for d1igob_: