SCOP 1.61: Domain d1igob_: 1igo B:

Lineage for d1igob_ (1igo B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (13 species)

7. Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry)

8. Domain d1igob_: 1igo B: [71210]

Details for d1igob_

PDB Entry: 1igo, 2.2 Å

PDB Description: Family 11 xylanase

SCOP Domain Sequences for d1igob_:

Sequence; same for both SEQRES and ATOM records:

>d1igob_ b.29.1.11 (B:) Xylanase II {Bacillus subtilis, B230}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl

Timeline for d1igob_:

• d1igob_ is new in SCOP 1.61
  
• d1igob_ appears in SCOP 1.63
  
• d1igob_ appears in the current release, SCOPe 2.08