SCOPe 2.08: Domain d1i5eb_: 1i5e B:

Lineage for d1i5eb_ (1i5e B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Uracil PRTase, Upp [53293] (5 species)

7. Species Bacillus caldolyticus [TaxId:1394] [75256] (1 PDB entry)

8. Domain d1i5eb_: 1i5e B: [71117]
   complexed with u5p

Details for d1i5eb_

PDB Entry: 1i5e, 3 Å

PDB Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump

PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d1i5eb_:

Sequence; same for both SEQRES and ATOM records:

>d1i5eb_ c.61.1.1 (B:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]}
gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
aalderlndhgyivpglgdagdrlfgtk

Timeline for d1i5eb_:

• d1i5eb_ first appeared in SCOP 1.61
  
• d1i5eb_ appears in SCOPe 2.07