Lineage for d1i5eb_ (1i5e B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183128Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 183129Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 183130Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 183236Protein Uracil PRTase [53293] (3 species)
  7. 183237Species Bacillus caldolyticus [TaxId:1394] [75256] (1 PDB entry)
  8. 183239Domain d1i5eb_: 1i5e B: [71117]

Details for d1i5eb_

PDB Entry: 1i5e (more details), 3 Å

PDB Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump

SCOP Domain Sequences for d1i5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5eb_ c.61.1.1 (B:) Uracil PRTase {Bacillus caldolyticus}
gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
aalderlndhgyivpglgdagdrlfgtk

SCOP Domain Coordinates for d1i5eb_:

Click to download the PDB-style file with coordinates for d1i5eb_.
(The format of our PDB-style files is described here.)

Timeline for d1i5eb_: