PDB entry 1i5e

View 1i5e on RCSB PDB site
Description: crystal structure of bacillus caldolyticus uracil phosphoribosyltransferase with bound ump
Class: transferase
Keywords: uracil phosphoribosyltransferase, salvage pathway, bacillus caldolyticus
Deposited on 2001-02-27, released 2002-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.223
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil phosphoribosyltransferase
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i5ea_
  • Chain 'B':
    Compound: uracil phosphoribosyltransferase
    Species: Bacillus caldolyticus [TaxId:1394]
    Gene: UPP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1i5eb_
  • Heterogens: U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i5eA (A:)
    mgkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvs
    karakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklps
    dveerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiy
    iaalderlndhgyivpglgdagdrlfgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i5eA (A:)
    gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
    arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
    veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
    aalderlndhgyivpglgdagdrlfgtk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i5eB (B:)
    mgkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvs
    karakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklps
    dveerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiy
    iaalderlndhgyivpglgdagdrlfgtk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i5eB (B:)
    gkvyvfdhpliqhkltyirdkntgtkefrelvdevatlmafeitrdlpleeveietpvsk
    arakviagkklgvipilragigmvdgilklipaakvghiglyrdpqtlkpveyyvklpsd
    veerdfiivdpmlatggsavaaidalkkrgaksikfmcliaapegvkavetahpdvdiyi
    aalderlndhgyivpglgdagdrlfgtk