![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins) |
![]() | Protein Hypoxanthine PRTase [53286] (3 species) |
![]() | Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries) Uniprot Q27796 |
![]() | Domain d1i0la_: 1i0l A: [71096] |
PDB Entry: 1i0l (more details), 1.72 Å
SCOP Domain Sequences for d1i0la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0la_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra lcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivntaltlnyly hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv lrpevyaereaa
Timeline for d1i0la_: