Lineage for d1i0la_ (1i0l A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998754Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 998755Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 998756Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 998811Protein Hypoxanthine PRTase [53286] (3 species)
  7. 998822Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)
    Uniprot Q27796
  8. 998825Domain d1i0la_: 1i0l A: [71096]
    complexed with 7hp, mg, prp; mutant

Details for d1i0la_

PDB Entry: 1i0l (more details), 1.72 Å

PDB Description: analysis of an invariant aspartic acid in hprts-asparagine mutant
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1i0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0la_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra
lcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivntaltlnyly
hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
lrpevyaereaa

SCOPe Domain Coordinates for d1i0la_:

Click to download the PDB-style file with coordinates for d1i0la_.
(The format of our PDB-style files is described here.)

Timeline for d1i0la_: