SCOP 1.73: Domain d1i0la_: 1i0l A:

Lineage for d1i0la_ (1i0l A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Hypoxanthine PRTase [53286] (3 species)

7. Species Trypanosoma cruzi [TaxId:5693] [53287] (9 PDB entries)

8. Domain d1i0la_: 1i0l A: [71096]

Details for d1i0la_

PDB Entry: 1i0l, 1.72 Å

PDB Description: analysis of an invariant aspartic acid in hprts-asparagine mutant

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOP Domain Sequences for d1i0la_:

Sequence; same for both SEQRES and ATOM records:

>d1i0la_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]}
yefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcra
lcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivntaltlnyly
hmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdivv
lrpevyaereaa

Timeline for d1i0la_:

• d1i0la_ first appeared in SCOP 1.61
  
• d1i0la_ appears in SCOP 1.71
  
• d1i0la_ appears in SCOP 1.75
  
• d1i0la_ appears in the current release, SCOPe 2.08