SCOPe 2.07: Domain d1h0ga2: 1h0g A:3-291,A:380-446

Lineage for d1h0ga2 (1h0g A:3-291,A:380-446)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitinase B, catalytic domain [51546] (1 species)

7. Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)

8. Domain d1h0ga2: 1h0g A:3-291,A:380-446 [70833]
   Other proteins in same PDB: d1h0ga1, d1h0ga3, d1h0gb1, d1h0gb3
   complexed with gol

Details for d1h0ga2

PDB Entry: 1h0g, 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys

PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1h0ga2:

Sequence; same for both SEQRES and ATOM records:

>d1h0ga2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrtk
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

Timeline for d1h0ga2:

• d1h0ga2 first appeared in SCOP 1.61
  
• d1h0ga2 appears in SCOPe 2.06
  
• d1h0ga2 appears in the current release, SCOPe 2.08