Lineage for d1h0ga1 (1h0g A:447-498)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420693Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2420848Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 2420849Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 2420856Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 2420857Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)
  8. 2420892Domain d1h0ga1: 1h0g A:447-498 [70832]
    Other proteins in same PDB: d1h0ga2, d1h0ga3, d1h0gb2, d1h0gb3
    complexed with gol

Details for d1h0ga1

PDB Entry: 1h0g (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1h0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ga1 b.72.2.1 (A:447-498) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrv

SCOPe Domain Coordinates for d1h0ga1:

Click to download the PDB-style file with coordinates for d1h0ga1.
(The format of our PDB-style files is described here.)

Timeline for d1h0ga1: