| Class b: All beta proteins [48724] (180 folds) |
| Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
| Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
| Protein Chitinase B, C-terminal domain [51061] (1 species) |
| Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries) |
| Domain d1h0ga1: 1h0g A:447-498 [70832] Other proteins in same PDB: d1h0ga2, d1h0ga3, d1h0gb2, d1h0gb3 complexed with gol |
PDB Entry: 1h0g (more details), 2 Å
SCOPe Domain Sequences for d1h0ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0ga1 b.72.2.1 (A:447-498) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrv
Timeline for d1h0ga1: