Lineage for d1h0ga2 (1h0g A:3-291,A:380-446)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173778Family c.1.8.5: Type II chitinase [51534] (9 proteins)
  6. 173792Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 173793Species Serratia marcescens [TaxId:615] [51547] (8 PDB entries)
  8. 173804Domain d1h0ga2: 1h0g A:3-291,A:380-446 [70833]
    Other proteins in same PDB: d1h0ga1, d1h0ga3, d1h0gb1, d1h0gb3

Details for d1h0ga2

PDB Entry: 1h0g (more details), 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys

SCOP Domain Sequences for d1h0ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h0ga2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrtk
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1h0ga2:

Click to download the PDB-style file with coordinates for d1h0ga2.
(The format of our PDB-style files is described here.)

Timeline for d1h0ga2: