SCOP 1.61: Domain d1h0gb1: 1h0g B:447-499

Lineage for d1h0gb1 (1h0g B:447-499)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.72: WW domain-like [51044] (2 superfamilies)

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (8 PDB entries)

8. Domain d1h0gb1: 1h0g B:447-499 [70835]
   Other proteins in same PDB: d1h0ga2, d1h0ga3, d1h0gb2, d1h0gb3

Details for d1h0gb1

PDB Entry: 1h0g, 2 Å

PDB Description: complex of a chitinase with the natural product cyclopentapeptide argadin from clonostachys

SCOP Domain Sequences for d1h0gb1:

Sequence; same for both SEQRES and ATOM records:

>d1h0gb1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1h0gb1:

• d1h0gb1 is new in SCOP 1.61
  
• d1h0gb1 appears in SCOP 1.63
  
• d1h0gb1 appears in the current release, SCOPe 2.08