SCOPe 2.03: Domain d1gzhd2: 1gzh D:1867-1970

Lineage for d1gzhd2 (1gzh D:1867-1970)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (5 families)
   Pfam PF00533

5. Family c.15.1.4: 53BP1 [75148] (1 protein)

6. Protein 53BP1 [75149] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries)

8. Domain d1gzhd2: 1gzh D:1867-1970 [70812]
   Other proteins in same PDB: d1gzha_, d1gzhc_
   complexed with so4, zn

Details for d1gzhd2

PDB Entry: 1gzh, 2.6 Å

PDB Description: Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor

PDB Compounds: (D:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1gzhd2:

Sequence; same for both SEQRES and ATOM records:

>d1gzhd2 c.15.1.4 (D:1867-1970) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
npfqnlkvllvsdqqqnflelwseilmtggaasvkqhhssahnkdialgvfdvvvtdpsc
pasvlkcaealqlpvvsqewviqclivgerigfkqhpkykhdyv

Timeline for d1gzhd2:

• d1gzhd2 first appeared in SCOP 1.61
  
• d1gzhd2 appears in SCOPe 2.02
  
• d1gzhd2 appears in SCOPe 2.04
  
• d1gzhd2 appears in the current release, SCOPe 2.08