Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (5 families) Pfam PF00533 |
Family c.15.1.4: 53BP1 [75148] (1 protein) |
Protein 53BP1 [75149] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries) |
Domain d1gzhb2: 1gzh B:1867-1972 [70809] Other proteins in same PDB: d1gzha_, d1gzhc_ complexed with so4, zn |
PDB Entry: 1gzh (more details), 2.6 Å
SCOPe Domain Sequences for d1gzhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gzhb2 c.15.1.4 (B:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} npfqnlkvllvsdqqqnflelwseilmtggaasvkqhhssahnkdialgvfdvvvtdpsc pasvlkcaealqlpvvsqewviqclivgerigfkqhpkykhdyvsh
Timeline for d1gzhb2:
View in 3D Domains from other chains: (mouse over for more information) d1gzha_, d1gzhc_, d1gzhd1, d1gzhd2 |