Lineage for d1gzhd1 (1gzh D:1725-1866)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1355197Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1355198Superfamily c.15.1: BRCT domain [52113] (5 families) (S)
    Pfam PF00533
  5. 1355282Family c.15.1.4: 53BP1 [75148] (1 protein)
  6. 1355283Protein 53BP1 [75149] (1 species)
  7. 1355284Species Human (Homo sapiens) [TaxId:9606] [75150] (2 PDB entries)
  8. 1355291Domain d1gzhd1: 1gzh D:1725-1866 [70811]
    Other proteins in same PDB: d1gzha_, d1gzhc_
    complexed with so4, zn

Details for d1gzhd1

PDB Entry: 1gzh (more details), 2.6 Å

PDB Description: Crystal structure of the BRCT domains of human 53BP1 bound to the p53 tumor supressor
PDB Compounds: (D:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1gzhd1:

Sequence, based on SEQRES records: (download)

>d1gzhd1 c.15.1.4 (D:1725-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
nktlflgyaflltmattsdklasrsklpdgptgsseeeeefleippfnkqytesqlraga
gyiledfneaqcntayqclliadqhcrtrkyflclasgipcvshvwvhdschanqlqnyr
nyllpagysleeqrildwqpre

Sequence, based on observed residues (ATOM records): (download)

>d1gzhd1 c.15.1.4 (D:1725-1866) 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
nktlflgyaflltmatfnkqytesqlragagyiledfnentayqclliadqhcrtrkyfl
clasgipcvshvwvhdschanqlqnyrnyllpagysleeqrildwqpre

SCOPe Domain Coordinates for d1gzhd1:

Click to download the PDB-style file with coordinates for d1gzhd1.
(The format of our PDB-style files is described here.)

Timeline for d1gzhd1: