Lineage for d1gyva_ (1gyv A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111269Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) (S)
    contains an additional N-terminal strand
  5. 1111291Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
    consist of a single subdomain
  6. 1111301Protein Gamma1-adaptin domain [74858] (1 species)
  7. 1111302Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)
  8. 1111303Domain d1gyva_: 1gyv A: [70790]
    mutant

Details for d1gyva_

PDB Entry: 1gyv (more details), 1.71 Å

PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant
PDB Compounds: (A:) adapter-related protein complex 1 gamma 1 subunit

SCOPe Domain Sequences for d1gyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyva_ b.1.10.2 (A:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlqe
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

SCOPe Domain Coordinates for d1gyva_:

Click to download the PDB-style file with coordinates for d1gyva_.
(The format of our PDB-style files is described here.)

Timeline for d1gyva_: