SCOPe 2.03: Domain d1gyva_: 1gyv A:

Lineage for d1gyva_ (1gyv A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.2: gamma-adaptin C-terminal appendage domain-like [74857] (4 proteins)
   consist of a single subdomain
   automatically mapped to Pfam PF02883

6. Protein Gamma1-adaptin domain [74858] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74859] (4 PDB entries)

8. Domain d1gyva_: 1gyv A: [70790]
   mutant

Details for d1gyva_

PDB Entry: 1gyv, 1.71 Å

PDB Description: gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant

PDB Compounds: (A:) adapter-related protein complex 1 gamma 1 subunit

SCOPe Domain Sequences for d1gyva_:

Sequence; same for both SEQRES and ATOM records:

>d1gyva_ b.1.10.2 (A:) Gamma1-adaptin domain {Human (Homo sapiens) [TaxId: 9606]}
mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlqe
lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq

Timeline for d1gyva_:

• d1gyva_ first appeared in SCOP 1.61
  
• d1gyva_ appears in SCOPe 2.02
  
• d1gyva_ appears in SCOPe 2.04
  
• d1gyva_ appears in the current release, SCOPe 2.08